(data stored in ACNUC7421 zone)

EMBL: CP000431.PE249

CP000431.PE249       Location/Qualifiers
FT   CDS             complement(322526..323758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92085"
FT                   /db_xref="GOA:Q0SK51"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK51"
FT                   /protein_id="ABG92085.1"
FT                   /translation="MIEAVTGLLARRTEPADARSDPPEHIDHDARVRGVAVGRLLAVAA
FT                   LTPEQAALLVADALHELELARGEGPYPFRLRNVTVSDAGHLTIECAGSASRRDMNEAVV
FT                   ELLRSIATNCRGSALADRLHESLAETTDLDALVHRVRQAIAPDVDPAEERRKRCQLAGL
FT                   VAATTGRPRPDTEVVGERTDVRDWPYVAAGSTLAPSGWFPPVRNPWHRKRRRPSRRQGA
FT                   LGLIAILILVAAAWMAPRVWSELRRGWDAVLNPVNPSEQNQIRPVSPPPPEPQADQPPS
FT                   ATIDVGRPPPPVDIGAPGSAGPITLVTVTRANGECLPGQACAIRVDIRLDPAAAVGAVT
FT                   WRVNVYDRCSGEVRPTSDVTLPVQPGSQQVYGIVRTDLPPGAALAVAAVTSAPATAASE
FT                   PLLVPAENARC"
     MIEAVTGLLA RRTEPADARS DPPEHIDHDA RVRGVAVGRL LAVAALTPEQ AALLVADALH        60
     ELELARGEGP YPFRLRNVTV SDAGHLTIEC AGSASRRDMN EAVVELLRSI ATNCRGSALA       120
     DRLHESLAET TDLDALVHRV RQAIAPDVDP AEERRKRCQL AGLVAATTGR PRPDTEVVGE       180
     RTDVRDWPYV AAGSTLAPSG WFPPVRNPWH RKRRRPSRRQ GALGLIAILI LVAAAWMAPR       240
     VWSELRRGWD AVLNPVNPSE QNQIRPVSPP PPEPQADQPP SATIDVGRPP PPVDIGAPGS       300
     AGPITLVTVT RANGECLPGQ ACAIRVDIRL DPAAAVGAVT WRVNVYDRCS GEVRPTSDVT       360
     LPVQPGSQQV YGIVRTDLPP GAALAVAAVT SAPATAASEP LLVPAENARC                  410
//

If you have problems or comments...

PBIL Back to PBIL home page