(data stored in ACNUC7421 zone)

EMBL: CP000431.PE25

CP000431.PE25        Location/Qualifiers
FT   CDS             complement(32241..32774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91861"
FT                   /db_xref="GOA:Q0SKS5"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS5"
FT                   /protein_id="ABG91861.1"
FT                   /translation="MRGSCRLESSVFLLVVAVVLSLVPLAAAFGTATRTRLDDQSRADR
FT                   ATRQQIAAVLLEDANVNLADTTPATGATGQAPARWAVAGTTHTGLVQTAPEAKTGQTIS
FT                   IWIDPAGKIVSAPKTGTENAFEAVGAALALWTMGTTICLTMMIGIRWAGTRYRMSQWDR
FT                   EWRNLGKAPGWPVS"
     MRGSCRLESS VFLLVVAVVL SLVPLAAAFG TATRTRLDDQ SRADRATRQQ IAAVLLEDAN        60
     VNLADTTPAT GATGQAPARW AVAGTTHTGL VQTAPEAKTG QTISIWIDPA GKIVSAPKTG       120
     TENAFEAVGA ALALWTMGTT ICLTMMIGIR WAGTRYRMSQ WDREWRNLGK APGWPVS          177
//

If you have problems or comments...

PBIL Back to PBIL home page