(data stored in ACNUC7421 zone)

EMBL: CP000431.PE250

CP000431.PE250       Location/Qualifiers
FT   CDS             complement(323973..325544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92086"
FT                   /db_xref="GOA:Q0SK50"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK50"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92086.1"
FT                   /translation="MGCAGPRPASTAKGMTSTNWTRWLPLAAVAVFVVVLAASGMVPVW
FT                   PGLLHLVALPPLDQFADLRLLLVRTASWPQFLVLLSVVSAVRVMLMAWLLGGLDARRLR
FT                   FAAMFYAAAFGPVLLATLGDATAYAALYSRAFWPAVALVGLLVVILGPVPWQGGVTVRG
FT                   AMARGWRRGLRIEVMVPYCAAVLGLGVLADRAPALTVLLLPVSAAATGLTVWAMDREPV
FT                   TRPVAALAAVLVVVTAASVIFVRTRGYDDPEPAPRQAGSLFLMSGINSRSGQGSIPRAD
FT                   VHRLGYECDQVYYFSYAGPGDGQPQRDSTCPIRSGAPYESADTQRPVEEQVALFAEQTA
FT                   NLQRPLTVAAHSHAAWIAWDAVATGRARVDVLVLVGVFPETPLGFPPPDGDRRGRVFGD
FT                   LLRWAAPVTDVVFFHFDPDTPAARQLLGTAGSAQAILGEPLPGEVRVLSITSAADLPLM
FT                   PHGWRLDVERNGCPVRAAHSSLPTSAAFEDEVIRFLDHRDPPPCPMWRDWGAVVMHAFG
FT                   SPPSGS"
     MGCAGPRPAS TAKGMTSTNW TRWLPLAAVA VFVVVLAASG MVPVWPGLLH LVALPPLDQF        60
     ADLRLLLVRT ASWPQFLVLL SVVSAVRVML MAWLLGGLDA RRLRFAAMFY AAAFGPVLLA       120
     TLGDATAYAA LYSRAFWPAV ALVGLLVVIL GPVPWQGGVT VRGAMARGWR RGLRIEVMVP       180
     YCAAVLGLGV LADRAPALTV LLLPVSAAAT GLTVWAMDRE PVTRPVAALA AVLVVVTAAS       240
     VIFVRTRGYD DPEPAPRQAG SLFLMSGINS RSGQGSIPRA DVHRLGYECD QVYYFSYAGP       300
     GDGQPQRDST CPIRSGAPYE SADTQRPVEE QVALFAEQTA NLQRPLTVAA HSHAAWIAWD       360
     AVATGRARVD VLVLVGVFPE TPLGFPPPDG DRRGRVFGDL LRWAAPVTDV VFFHFDPDTP       420
     AARQLLGTAG SAQAILGEPL PGEVRVLSIT SAADLPLMPH GWRLDVERNG CPVRAAHSSL       480
     PTSAAFEDEV IRFLDHRDPP PCPMWRDWGA VVMHAFGSPP SGS                         523
//

If you have problems or comments...

PBIL Back to PBIL home page