(data stored in ACNUC7421 zone)

EMBL: CP000431.PE251

CP000431.PE251       Location/Qualifiers
FT   CDS             325703..326185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92087"
FT                   /db_xref="GOA:Q0SK49"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK49"
FT                   /protein_id="ABG92087.1"
FT                   /translation="MERAEAGSRGTLMTFDQFADIFRDVASLGVVREDFHRFDDVVTAK
FT                   LYDLLLVAQESAAAQHRHIVEPTDLPITRGLQENIGLFRELGPGLRVDPIVERLADYPP
FT                   LDGILATETRSGLADITGGLSVALARTFRVVYPELRTVRARTTHWSVISTLVDLYL"
     MERAEAGSRG TLMTFDQFAD IFRDVASLGV VREDFHRFDD VVTAKLYDLL LVAQESAAAQ        60
     HRHIVEPTDL PITRGLQENI GLFRELGPGL RVDPIVERLA DYPPLDGILA TETRSGLADI       120
     TGGLSVALAR TFRVVYPELR TVRARTTHWS VISTLVDLYL                             160
//

If you have problems or comments...

PBIL Back to PBIL home page