(data stored in ACNUC7421 zone)

EMBL: CP000431.PE252

CP000431.PE252       Location/Qualifiers
FT   CDS             326374..326796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92088"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK48"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92088.1"
FT                   /translation="MNSTKTRIAAAAATGAALGLGMFMAQSATAAAAPAQSTFPQVVSP
FT                   ESGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTTLYGPAA
FT                   ATVDSQQGATIHQVYYPLEPDDGVISHSLDPDMPWM"
     MNSTKTRIAA AAATGAALGL GMFMAQSATA AAAPAQSTFP QVVSPESGLS PYKVEVRDRI        60
     GCANAWPMVA CDAPDEDVPP QVTLVEPGTT LVEPGGTTLY GPAAATVDSQ QGATIHQVYY       120
     PLEPDDGVIS HSLDPDMPWM                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page