(data stored in ACNUC7421 zone)

EMBL: CP000431.PE253

CP000431.PE253       Location/Qualifiers
FT   CDS             327004..328536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00253"
FT                   /product="amino acid permease, APC superfamily protein"
FT                   /note="tc: 2.A.3; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_process: GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92089"
FT                   /db_xref="GOA:Q0SK47"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK47"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92089.1"
FT                   /translation="MTGLYRDSLPRKFPIEREAAQMTAEDVVGAQIADQECQDCGYKPE
FT                   LKRTLGSFQVFAVSFAFISVAVGIFGTYDDVLRDAGPVGIWLWVIVALGQTLVALVIAQ
FT                   FAARIPLSGSSYQWASRLANPKIGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQP
FT                   DENTARVITLVVVLVQAVLVVFSTRLVGLITSGAVGLELVIVVVLAIGLFAAVAISGEG
FT                   SVGNLTSRGITEGAPNYFAVGGGLMAAMIMGLATLVGFDSAANMAEEAKDPFRSVPRAI
FT                   VGSVVAAAVLGLVFLIALTIAIKDIPRVSASDTPVAAILRDQLGPVMERTLLVAIAFAF
FT                   FGAGMVTLATCSRMVFAMSRDARFPAYRLMRRVNPRTQTPIPATIMIVVVGVVLMAVLP
FT                   GGALLELLTVGTVISAVLYGAIILLYLAVRRRLDRKEGAFDLGRFELPVAIGALLWSAV
FT                   VLFVIVSPSSALTSILIAVGLLLAGGLYFAYLLIFKREVLDTEPGDADVFSH"
     MTGLYRDSLP RKFPIEREAA QMTAEDVVGA QIADQECQDC GYKPELKRTL GSFQVFAVSF        60
     AFISVAVGIF GTYDDVLRDA GPVGIWLWVI VALGQTLVAL VIAQFAARIP LSGSSYQWAS       120
     RLANPKIGWL FGWLTFCYLA LGVVTVDNAM ASSALMPLFG MQPDENTARV ITLVVVLVQA       180
     VLVVFSTRLV GLITSGAVGL ELVIVVVLAI GLFAAVAISG EGSVGNLTSR GITEGAPNYF       240
     AVGGGLMAAM IMGLATLVGF DSAANMAEEA KDPFRSVPRA IVGSVVAAAV LGLVFLIALT       300
     IAIKDIPRVS ASDTPVAAIL RDQLGPVMER TLLVAIAFAF FGAGMVTLAT CSRMVFAMSR       360
     DARFPAYRLM RRVNPRTQTP IPATIMIVVV GVVLMAVLPG GALLELLTVG TVISAVLYGA       420
     IILLYLAVRR RLDRKEGAFD LGRFELPVAI GALLWSAVVL FVIVSPSSAL TSILIAVGLL       480
     LAGGLYFAYL LIFKREVLDT EPGDADVFSH                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page