(data stored in ACNUC7421 zone)

EMBL: CP000431.PE257

CP000431.PE257       Location/Qualifiers
FT   CDS             complement(330973..332238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92093"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK43"
FT                   /protein_id="ABG92093.1"
FT                   /translation="MSVTGVGPVLDTGRAEGAAAALRTTSAVRERARQLLSRAREGDSL
FT                   WFGVDDDALEAAAAEVADVTRARYPDLKIPYHSRWRHFEAGGVDRKAELDARLTALDAP
FT                   GRARAMIDLAVVSVLLDAGAGPDWHYHEVHGGQRFARSEGLGVASWHAFLSGLFSSDAA
FT                   HPLQVDAAGLCGLDTDRLAEVFQAGPSNPLVGLEGRVLLLRRLGEALAAQPEVFGTHGR
FT                   PGGLFDLLVAPQGAATATVAAHDILSQLLTSLSGIWPTGNAIDAEPLGDVWRHDAVAGP
FT                   GLTRGWMPFHKLSQWLSYSLLEPFQWAGVRVVGLDELTGLPEYRNGGLLLDTGVLRLHD
FT                   PAWAAQNWTAGDELVVEWRALTVALLDELAPLVRARLGVDPGEMPLACVLEGGTWAAGR
FT                   ALAQRSRGGLPPLNIVSDGTVF"
     MSVTGVGPVL DTGRAEGAAA ALRTTSAVRE RARQLLSRAR EGDSLWFGVD DDALEAAAAE        60
     VADVTRARYP DLKIPYHSRW RHFEAGGVDR KAELDARLTA LDAPGRARAM IDLAVVSVLL       120
     DAGAGPDWHY HEVHGGQRFA RSEGLGVASW HAFLSGLFSS DAAHPLQVDA AGLCGLDTDR       180
     LAEVFQAGPS NPLVGLEGRV LLLRRLGEAL AAQPEVFGTH GRPGGLFDLL VAPQGAATAT       240
     VAAHDILSQL LTSLSGIWPT GNAIDAEPLG DVWRHDAVAG PGLTRGWMPF HKLSQWLSYS       300
     LLEPFQWAGV RVVGLDELTG LPEYRNGGLL LDTGVLRLHD PAWAAQNWTA GDELVVEWRA       360
     LTVALLDELA PLVRARLGVD PGEMPLACVL EGGTWAAGRA LAQRSRGGLP PLNIVSDGTV       420
     F                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page