(data stored in ACNUC7421 zone)

EMBL: CP000431.PE259

CP000431.PE259       Location/Qualifiers
FT   CDS             333624..335081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92095"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK41"
FT                   /protein_id="ABG92095.1"
FT                   /translation="MWRRRRRANADEVHGDRAWDSVAEVTKNRARAVDLRTQIEADDVF
FT                   ARGYALRATVPSSAHESAAVGAGRPDVLDFVEASNRGRLANLIPLRIGRMIASPFAFFR
FT                   GAAGLMAADLADSPVTGLTAQLCGDAHAANFGLYGTPDGHIVMDINDFDETLPGPWEWD
FT                   LKRLAASLVLAGREGGVSENGCIEAAEDAVKSYRRTIRDLAELPFLQSWNALPDKSVLE
FT                   RAKADALLDDFDKAAQKARRNTSEKVAAKWTAHLEDHETGIRRRRFIDDPPVLTHVDRA
FT                   TADAVTDGLELYVDSLRESRRNLIARFAVSDVAFRIVGTGSVGLRSYIALLHGNRDEVL
FT                   VLQLKQARPSALSAYLPVDEPKHEGKRIVHGARLVQAESDILLGWTTIDGLPFIVRQFR
FT                   NLKGDIDPTGLEQDHLDDYGRLAGALLARAHTRSLDPRVLAGYFANDTELDEVIGRYAV
FT                   SYADQTEADHATLVAAVKSGRIAAEPA"
     MWRRRRRANA DEVHGDRAWD SVAEVTKNRA RAVDLRTQIE ADDVFARGYA LRATVPSSAH        60
     ESAAVGAGRP DVLDFVEASN RGRLANLIPL RIGRMIASPF AFFRGAAGLM AADLADSPVT       120
     GLTAQLCGDA HAANFGLYGT PDGHIVMDIN DFDETLPGPW EWDLKRLAAS LVLAGREGGV       180
     SENGCIEAAE DAVKSYRRTI RDLAELPFLQ SWNALPDKSV LERAKADALL DDFDKAAQKA       240
     RRNTSEKVAA KWTAHLEDHE TGIRRRRFID DPPVLTHVDR ATADAVTDGL ELYVDSLRES       300
     RRNLIARFAV SDVAFRIVGT GSVGLRSYIA LLHGNRDEVL VLQLKQARPS ALSAYLPVDE       360
     PKHEGKRIVH GARLVQAESD ILLGWTTIDG LPFIVRQFRN LKGDIDPTGL EQDHLDDYGR       420
     LAGALLARAH TRSLDPRVLA GYFANDTELD EVIGRYAVSY ADQTEADHAT LVAAVKSGRI       480
     AAEPA                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page