(data stored in ACNUC7421 zone)

EMBL: CP000431.PE26

CP000431.PE26        Location/Qualifiers
FT   CDS             complement(32906..33760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00026"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91862"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS4"
FT                   /protein_id="ABG91862.1"
FT                   /translation="MVDPAIVVGVDGSGPALDAVRWAAREATVRRAPLLLLSCITYRGT
FT                   EDGPRLAETLHARAERNVAEARETARAGSADADLDIRAEVSHQNAPGSLVDRSAGAEMV
FT                   VLGRRGLGEFTDGLIGSVTSAVVRHAQCPVAVIDGWSRVADGTGPVVVGIDGSPSSARA
FT                   VGLAFEECSLHNAELIALHAWSDQDLSILPVGVEQTAERSVLDAAVAEWCERFPDVSVR
FT                   RTLVRDRPVRHLLEMADEAQMIVVGSRGRGGFPGMTLGSTSAALVHITPCPLLIAGPIR
FT                   PGR"
     MVDPAIVVGV DGSGPALDAV RWAAREATVR RAPLLLLSCI TYRGTEDGPR LAETLHARAE        60
     RNVAEARETA RAGSADADLD IRAEVSHQNA PGSLVDRSAG AEMVVLGRRG LGEFTDGLIG       120
     SVTSAVVRHA QCPVAVIDGW SRVADGTGPV VVGIDGSPSS ARAVGLAFEE CSLHNAELIA       180
     LHAWSDQDLS ILPVGVEQTA ERSVLDAAVA EWCERFPDVS VRRTLVRDRP VRHLLEMADE       240
     AQMIVVGSRG RGGFPGMTLG STSAALVHIT PCPLLIAGPI RPGR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page