(data stored in ACNUC7421 zone)

EMBL: CP000431.PE260

CP000431.PE260       Location/Qualifiers
FT   CDS             complement(335334..335801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92096"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK40"
FT                   /protein_id="ABG92096.1"
FT                   /translation="MRRRGCRVVVFTDERLVRMNRRRWSLRRAVLVVGLAATPLVWCPG
FT                   AATAAPVSAPFQIPRVWASGTFGYCFPACIDVPVAVTGDAPGVVTFHDPALMETVVLWV
FT                   GWTNLSNGTSGVASVTKDKPGVAHTGTGVVTASAMGNLVEYVGARGIFYVP"
     MRRRGCRVVV FTDERLVRMN RRRWSLRRAV LVVGLAATPL VWCPGAATAA PVSAPFQIPR        60
     VWASGTFGYC FPACIDVPVA VTGDAPGVVT FHDPALMETV VLWVGWTNLS NGTSGVASVT       120
     KDKPGVAHTG TGVVTASAMG NLVEYVGARG IFYVP                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page