(data stored in ACNUC7421 zone)

EMBL: CP000431.PE261

CP000431.PE261       Location/Qualifiers
FT   CDS             complement(336038..336454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92097"
FT                   /db_xref="GOA:Q0SK39"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK39"
FT                   /protein_id="ABG92097.1"
FT                   /translation="MESLALASTVFEHFAPTTTRRRPPRTERVDGRARDLVPARAPSIH
FT                   LRVVVTWVSIFPLVTLGMTVMTLSGPITSTWPTWLRALSLTGVVVPTAVYLVVPRVLDL
FT                   SVRWMTWRCRRSAGAESCESLQAARAMRSHSHQY"
     MESLALASTV FEHFAPTTTR RRPPRTERVD GRARDLVPAR APSIHLRVVV TWVSIFPLVT        60
     LGMTVMTLSG PITSTWPTWL RALSLTGVVV PTAVYLVVPR VLDLSVRWMT WRCRRSAGAE       120
     SCESLQAARA MRSHSHQY                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page