(data stored in ACNUC7421 zone)

EMBL: CP000431.PE262

CP000431.PE262       Location/Qualifiers
FT   CDS             336560..337249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00262"
FT                   /product="probable transcriptional regulator, TetR family
FT                   protein"
FT                   /note="GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92098"
FT                   /db_xref="GOA:Q0SK38"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK38"
FT                   /protein_id="ABG92098.1"
FT                   /translation="MAWDTERTKRLLIEAGVAEFSSFGLAGARVDRIAAKAGVNKERIY
FT                   QYFGKKEAFFSAVLEHELATTLAAVELSGHGVVAIADYAGRRFDYQREHPTFTRLLFWE
FT                   GLELEAPVAEASRQKHAQAIVASAREAVPELSESDAQELLITVITLVDGWVALQTADRL
FT                   FSPPLPRGRDRDSRRRDFIVMTVEAATRAALTRSQSARTQPTAGSPRMGDAGSALRSSR
FT                   ADRAGKV"
     MAWDTERTKR LLIEAGVAEF SSFGLAGARV DRIAAKAGVN KERIYQYFGK KEAFFSAVLE        60
     HELATTLAAV ELSGHGVVAI ADYAGRRFDY QREHPTFTRL LFWEGLELEA PVAEASRQKH       120
     AQAIVASARE AVPELSESDA QELLITVITL VDGWVALQTA DRLFSPPLPR GRDRDSRRRD       180
     FIVMTVEAAT RAALTRSQSA RTQPTAGSPR MGDAGSALRS SRADRAGKV                   229
//

If you have problems or comments...

PBIL Back to PBIL home page