(data stored in ACNUC7421 zone)

EMBL: CP000431.PE264

CP000431.PE264       Location/Qualifiers
FT   CDS             338405..338959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92100"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK36"
FT                   /protein_id="ABG92100.1"
FT                   /translation="MRSGKFPRMETASWVGAAAAVLFGATTAAAWRKAALADQARREAE
FT                   VALDVALEQVTALTRIAEAAQRAFPQPEHVEFEVQRIRGPVDRFRLRNVGTGIATDVRF
FT                   VVDPVEEQNRRIPTPQWLQEEPVTLLPKEWADFAASALSPVSGSWRIVFPAFVTVICDE
FT                   AGAPQRVDLPTVVVAEDGVIG"
     MRSGKFPRME TASWVGAAAA VLFGATTAAA WRKAALADQA RREAEVALDV ALEQVTALTR        60
     IAEAAQRAFP QPEHVEFEVQ RIRGPVDRFR LRNVGTGIAT DVRFVVDPVE EQNRRIPTPQ       120
     WLQEEPVTLL PKEWADFAAS ALSPVSGSWR IVFPAFVTVI CDEAGAPQRV DLPTVVVAED       180
     GVIG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page