(data stored in ACNUC7421 zone)

EMBL: CP000431.PE265

CP000431.PE265       Location/Qualifiers
FT   CDS             complement(338994..339521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00265"
FT                   /product="possible transcriptional regulator, PadR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92101"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK35"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92101.1"
FT                   /translation="MAERPLNATAASLLGFLHEGSKTGWDLVVTAQERIGKFWSITTSQ
FT                   VYRELAAMERGGLIEAGERGARERKPYTLTEDGRRAFAEWIERDPAPENIRYPMLLTVA
FT                   FGAHLPPERLAAMLDSHRAAHESQLAEYERDAAVHGSNRFALATLDFGIVYERAVLEWF
FT                   DRVGNRLGQESR"
     MAERPLNATA ASLLGFLHEG SKTGWDLVVT AQERIGKFWS ITTSQVYREL AAMERGGLIE        60
     AGERGARERK PYTLTEDGRR AFAEWIERDP APENIRYPML LTVAFGAHLP PERLAAMLDS       120
     HRAAHESQLA EYERDAAVHG SNRFALATLD FGIVYERAVL EWFDRVGNRL GQESR            175
//

If you have problems or comments...

PBIL Back to PBIL home page