(data stored in ACNUC7421 zone)

EMBL: CP000431.PE266

CP000431.PE266       Location/Qualifiers
FT   CDS             339520..340107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92102"
FT                   /db_xref="GOA:Q0SK34"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK34"
FT                   /protein_id="ABG92102.1"
FT                   /translation="MARSFAQSGVDIPLWHIDHSGSDIPQWNVIAEEGPMQYADNIRIS
FT                   DSEREQVVGELGRHLTEGRLTIGEFDQRVAQVYQSTTQQQAHQVLRDLPSAPQAVALAP
FT                   PRAPTAHPSRRRIPGHQRIEWLAWLAAGGINIAIWGIVSLATGVMIYPWPIWVIGPWGL
FT                   VLLGRTALGREGGCSRITDALHDDRTKVAVSR"
     MARSFAQSGV DIPLWHIDHS GSDIPQWNVI AEEGPMQYAD NIRISDSERE QVVGELGRHL        60
     TEGRLTIGEF DQRVAQVYQS TTQQQAHQVL RDLPSAPQAV ALAPPRAPTA HPSRRRIPGH       120
     QRIEWLAWLA AGGINIAIWG IVSLATGVMI YPWPIWVIGP WGLVLLGRTA LGREGGCSRI       180
     TDALHDDRTK VAVSR                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page