(data stored in ACNUC7421 zone)

EMBL: CP000431.PE267

CP000431.PE267       Location/Qualifiers
FT   CDS             340513..340839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92103"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK33"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92103.1"
FT                   /translation="MNAEPITCGDYVTATFARDFVAEGFDHDAVERIYSGLFDEWSHAL
FT                   AQSGLFTNRTVAAALHSWQDDPHSLLDALLANADEMTLKRYDLVWEALERSHVGSAEPL
FT                   AEYA"
     MNAEPITCGD YVTATFARDF VAEGFDHDAV ERIYSGLFDE WSHALAQSGL FTNRTVAAAL        60
     HSWQDDPHSL LDALLANADE MTLKRYDLVW EALERSHVGS AEPLAEYA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page