(data stored in ACNUC7421 zone)

EMBL: CP000431.PE268

CP000431.PE268       Location/Qualifiers
FT   CDS             341134..341385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92104"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK32"
FT                   /protein_id="ABG92104.1"
FT                   /translation="MNVQAMQVSTAPEGLGRYRDAVDALHAFDNPGHRTDPRTALLFDS
FT                   LTDDLIEAAQTAGAGDTVSQRDIVAVIDTAISRPRPSL"
     MNVQAMQVST APEGLGRYRD AVDALHAFDN PGHRTDPRTA LLFDSLTDDL IEAAQTAGAG        60
     DTVSQRDIVA VIDTAISRPR PSL                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page