(data stored in ACNUC7421 zone)

EMBL: CP000431.PE269

CP000431.PE269       Location/Qualifiers
FT   CDS             complement(341424..341837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00269"
FT                   /product="possible redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92105"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK31"
FT                   /protein_id="ABG92105.1"
FT                   /translation="MSSGVAEVSGHTVSGVPGRFILDARENHLVSDSRFGPAEAIQAGE
FT                   LLLAAIVSCAMANIQSNAEADDIRVEHIEVHASHRRGTADPTRYDFTEVRIEIHGVDQP
FT                   TADSLAARFESSCPIYNTIRRGSGIELTVTAHS"
     MSSGVAEVSG HTVSGVPGRF ILDARENHLV SDSRFGPAEA IQAGELLLAA IVSCAMANIQ        60
     SNAEADDIRV EHIEVHASHR RGTADPTRYD FTEVRIEIHG VDQPTADSLA ARFESSCPIY       120
     NTIRRGSGIE LTVTAHS                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page