(data stored in ACNUC7421 zone)

EMBL: CP000431.PE27

CP000431.PE27        Location/Qualifiers
FT   CDS             complement(33810..34826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91863"
FT                   /db_xref="GOA:Q0SKS3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS3"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91863.1"
FT                   /translation="MNTRAVPTVPDRRTVESAVALACRAPSLHNSQPWRWVMGTALRLY
FT                   SDPDRLLPATDGFGRQMVISCGAALNHLEYAFTANHWRLVIERLPHSSDRQLLSTINFI
FT                   PAPAPTDFVARMAVAIGRRRTERLPMDPPPAWADTLEQLVRITAGTGVELEDLGQRSRP
FT                   ALEEASRRMTGLRHDDPTYQAELRWWSGRGLFPDGVPEQARPSDRQQHSVHLSREFPPG
FT                   RASTPDGGPSEDRAAILLLSTSADSRLDWLRSGEVLSAVLLACTDRGLGTCPVTHLTER
FT                   AVTRTLLRELSSGEGMPQVLIRVGAGTGVGEPSTTPRRPLSEVLVRERPAPGHLPGE"
     MNTRAVPTVP DRRTVESAVA LACRAPSLHN SQPWRWVMGT ALRLYSDPDR LLPATDGFGR        60
     QMVISCGAAL NHLEYAFTAN HWRLVIERLP HSSDRQLLST INFIPAPAPT DFVARMAVAI       120
     GRRRTERLPM DPPPAWADTL EQLVRITAGT GVELEDLGQR SRPALEEASR RMTGLRHDDP       180
     TYQAELRWWS GRGLFPDGVP EQARPSDRQQ HSVHLSREFP PGRASTPDGG PSEDRAAILL       240
     LSTSADSRLD WLRSGEVLSA VLLACTDRGL GTCPVTHLTE RAVTRTLLRE LSSGEGMPQV       300
     LIRVGAGTGV GEPSTTPRRP LSEVLVRERP APGHLPGE                               338
//

If you have problems or comments...

PBIL Back to PBIL home page