(data stored in ACNUC7421 zone)

EMBL: CP000431.PE270

CP000431.PE270       Location/Qualifiers
FT   CDS             complement(341834..343198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00270"
FT                   /product="probable dibenzothiophene desulfurziation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92106"
FT                   /db_xref="GOA:Q0SK30"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK30"
FT                   /protein_id="ABG92106.1"
FT                   /translation="MSPSRMHLAAFVTAGPGRPGGWRYPGSVPGWLSAGYYQNIARTLE
FT                   DARFDLVFFADILSVPDRFGGSPDSQLRNGALGSMRLDPLHVLSSMGAVTSHLGLAATV
FT                   STTYAQPFTVARSFATLDHLTEGRAAWNVVTSFQESEARNFNRDEQFPRDQRYERADEF
FT                   LEVAGKLWDSWEDDALVLDTEQPLFADPDRVHPIRHKGDWFTVQGPLNVPRPPQGYPVV
FT                   IQAGASAKGKDFAARWSDVIFCSHASLESAQDFYKEIKERAAAHGRDPESVKILPSIAP
FT                   VVGATTAIAQQTFEELFDLVPPLGGLSTLAYHLDVDLSTFPLDERLPDVEVPGVEGHYQ
FT                   EVREMTEREGLTLRELGKRYGGRVEGGFIGTATEVADGLGEWFGQGACDGFMVQAPYQP
FT                   GGFEDFTRHVVPELQKRGLFRKEYEGSNLRENLGLPRVQSGEWANRVRRGAEAAL"
     MSPSRMHLAA FVTAGPGRPG GWRYPGSVPG WLSAGYYQNI ARTLEDARFD LVFFADILSV        60
     PDRFGGSPDS QLRNGALGSM RLDPLHVLSS MGAVTSHLGL AATVSTTYAQ PFTVARSFAT       120
     LDHLTEGRAA WNVVTSFQES EARNFNRDEQ FPRDQRYERA DEFLEVAGKL WDSWEDDALV       180
     LDTEQPLFAD PDRVHPIRHK GDWFTVQGPL NVPRPPQGYP VVIQAGASAK GKDFAARWSD       240
     VIFCSHASLE SAQDFYKEIK ERAAAHGRDP ESVKILPSIA PVVGATTAIA QQTFEELFDL       300
     VPPLGGLSTL AYHLDVDLST FPLDERLPDV EVPGVEGHYQ EVREMTEREG LTLRELGKRY       360
     GGRVEGGFIG TATEVADGLG EWFGQGACDG FMVQAPYQPG GFEDFTRHVV PELQKRGLFR       420
     KEYEGSNLRE NLGLPRVQSG EWANRVRRGA EAAL                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page