(data stored in ACNUC7421 zone)

EMBL: CP000431.PE272

CP000431.PE272       Location/Qualifiers
FT   CDS             complement(344350..345087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00272"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /note="tc: 3.A.1.17; GO_component: GO:0019866 - organelle
FT                   inner membrane; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0015171 - amino acid transporter activity;
FT                   GO_function: GO:0016887 - ATPase activity; GO_process:
FT                   GO:0006811 - ion transport; GO_process: GO:0006865 - amino
FT                   acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92108"
FT                   /db_xref="GOA:Q0SK28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0SK28"
FT                   /protein_id="ABG92108.1"
FT                   /translation="MPATNLVGLDLVGIGHRYRDTTVLHDIDLTVEPGEFVSFLGPSGV
FT                   GKSTLLRIIAGLEQPTHGVVESTGGTSGGTMSRMMFQEDRLLPWRNVLDNVQLGTRHQR
FT                   ERALELLYDVGLAGREKDWPSELSGGQRQRVALARALLHQPDVLLLDEPFGALDAITRV
FT                   AMQQLLERVLAEQPRTVLLVTHDVEEALVLSDRVLLLTDQGITRDLRIPHARPRHRGDA
FT                   QLAAWKEELLDGLLQADNALSSL"
     MPATNLVGLD LVGIGHRYRD TTVLHDIDLT VEPGEFVSFL GPSGVGKSTL LRIIAGLEQP        60
     THGVVESTGG TSGGTMSRMM FQEDRLLPWR NVLDNVQLGT RHQRERALEL LYDVGLAGRE       120
     KDWPSELSGG QRQRVALARA LLHQPDVLLL DEPFGALDAI TRVAMQQLLE RVLAEQPRTV       180
     LLVTHDVEEA LVLSDRVLLL TDQGITRDLR IPHARPRHRG DAQLAAWKEE LLDGLLQADN       240
     ALSSL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page