(data stored in ACNUC7421 zone)

EMBL: CP000431.PE274

CP000431.PE274       Location/Qualifiers
FT   CDS             346176..346799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00274"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92110"
FT                   /db_xref="GOA:Q0SK26"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK26"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92110.1"
FT                   /translation="MERESSAYKQLRERITGGADRPGTMLIPATIGAELGLSRTPVREA
FT                   LQRLEYEGLVVQAPRGYRVRERTPEEVLEICEARIALESAIAYSAATRHTELDLARLSR
FT                   LFEQAIESPDPATSLALHNEWHTALRSAAHNQTIAQLMDRLDAQLRVYDAEEAQASSNL
FT                   QQIETEHREILTAVQSGDAEKARILMIAHQARTRDLRIAAMARR"
     MERESSAYKQ LRERITGGAD RPGTMLIPAT IGAELGLSRT PVREALQRLE YEGLVVQAPR        60
     GYRVRERTPE EVLEICEARI ALESAIAYSA ATRHTELDLA RLSRLFEQAI ESPDPATSLA       120
     LHNEWHTALR SAAHNQTIAQ LMDRLDAQLR VYDAEEAQAS SNLQQIETEH REILTAVQSG       180
     DAEKARILMI AHQARTRDLR IAAMARR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page