(data stored in ACNUC7421 zone)

EMBL: CP000431.PE275

CP000431.PE275       Location/Qualifiers
FT   CDS             346902..347624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92111"
FT                   /db_xref="GOA:Q0SK25"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK25"
FT                   /protein_id="ABG92111.1"
FT                   /translation="MTNDRGEDPKSRPSPGMRRRLPWLLLAAVVVVVGAVAVVAYVLTS
FT                   GADDGREARDFSPSADNPDPSLGIEGIVTVDYPPADHVQALQRVAYDQSPPFGGAHDQY
FT                   WATCTGIVYPEAIRSENAVHSLEHGAVWVTYDPDRLDDDDIAALAANVEGEPYTLMSPY
FT                   PGLDSAVSLQSWGHQLKLDDVTDPRISDFLTALRQNPNTYPEPGATCSTVRGGFDPADP
FT                   PPFDPSAPGPDAVPVDGK"
     MTNDRGEDPK SRPSPGMRRR LPWLLLAAVV VVVGAVAVVA YVLTSGADDG REARDFSPSA        60
     DNPDPSLGIE GIVTVDYPPA DHVQALQRVA YDQSPPFGGA HDQYWATCTG IVYPEAIRSE       120
     NAVHSLEHGA VWVTYDPDRL DDDDIAALAA NVEGEPYTLM SPYPGLDSAV SLQSWGHQLK       180
     LDDVTDPRIS DFLTALRQNP NTYPEPGATC STVRGGFDPA DPPPFDPSAP GPDAVPVDGK       240
//

If you have problems or comments...

PBIL Back to PBIL home page