(data stored in ACNUC7421 zone)

EMBL: CP000431.PE277

CP000431.PE277       Location/Qualifiers
FT   CDS             complement(348985..349350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92113"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK23"
FT                   /protein_id="ABG92113.1"
FT                   /translation="MSNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRETLMFLTKEAV
FT                   RLALDGTIQGVACEGCPPLPDLAARFATAGGIYMVCPICFEAKHLDKDALVSNAELAGT
FT                   VPMWKWIGDEGAVTFSY"
     MSNKAVVSLT TGLEDAEKVT VAFLVAVGAA EQQRETLMFL TKEAVRLALD GTIQGVACEG        60
     CPPLPDLAAR FATAGGIYMV CPICFEAKHL DKDALVSNAE LAGTVPMWKW IGDEGAVTFS       120
     Y                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page