(data stored in ACNUC7421 zone)

EMBL: CP000431.PE278

CP000431.PE278       Location/Qualifiers
FT   CDS             349515..350399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92114"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK22"
FT                   /protein_id="ABG92114.1"
FT                   /translation="MPLRLAVRHDRSTRASAAERIGIHPRMLTRMGAEPRQQARVSHGG
FT                   TTALFTLLPDTDVDEIDTIRITAGGCRRLGAAPGQTVTLDRRCTASAMTEEEAEMGGEF
FT                   IERLEDDGRHHRLVVLAPHGGAIETRTDQQAEQVVASLGSRDSTLWVCKGWRPVGNAYR
FT                   AWHISSTDLSVHSFPLLRSLSARRFRWALSFHGYRGNDVLIGGRAPARLKSDVRNAIAK
FT                   ALDGSGICVRVAERGERHSGESASNLVNRLTIDAAGGIQIEQSRAARTLHGPAIAAAVS
FT                   EVYDTWIAADNLR"
     MPLRLAVRHD RSTRASAAER IGIHPRMLTR MGAEPRQQAR VSHGGTTALF TLLPDTDVDE        60
     IDTIRITAGG CRRLGAAPGQ TVTLDRRCTA SAMTEEEAEM GGEFIERLED DGRHHRLVVL       120
     APHGGAIETR TDQQAEQVVA SLGSRDSTLW VCKGWRPVGN AYRAWHISST DLSVHSFPLL       180
     RSLSARRFRW ALSFHGYRGN DVLIGGRAPA RLKSDVRNAI AKALDGSGIC VRVAERGERH       240
     SGESASNLVN RLTIDAAGGI QIEQSRAART LHGPAIAAAV SEVYDTWIAA DNLR             294
//

If you have problems or comments...

PBIL Back to PBIL home page