(data stored in ACNUC7421 zone)

EMBL: CP000431.PE279

CP000431.PE279       Location/Qualifiers
FT   CDS             complement(350404..351666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00279"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_function: GO:0004674 - protein serine/threonine
FT                   kinase activity; GO_function: GO:0004713 - protein-tyrosine
FT                   kinase activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0016853 - isomerase activity; GO_process:
FT                   GO:0006468 - protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92115"
FT                   /db_xref="GOA:Q0SK21"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK21"
FT                   /protein_id="ABG92115.1"
FT                   /translation="MQVGALFGRYRLDRSLTVDVSGEVWAAFDTVMFRQVVVRVLPPDA
FT                   TEDDEYCDRFEREAGIAAQIRNPHIVPIHDFGQVGNRLFLATPVTQGTNLRTILQSTGP
FT                   MEVSRAVGVVEQLASALEAVRVAGLVEQEVSSANVVVQDGGLVQLTDVGLPTILGAASG
FT                   VYGLTCVLYECLTGEVFPTSAIPTPPVGMAAVIARGTAADPARRYRSVGELAAAARVAA
FT                   PPQQPAVEPAPATPPIDRNRRLIVAGLALAAIVAVAIVGGVIIGSGTSSPHVAVPTPSS
FT                   SAARPASPSSSPSAMANPTAAEQEPPVQAPPPTETPVAEAPIQEEAIPTPAPQSPPVVP
FT                   APAPPPGASAPQVLPCYPGYEHTPPPDGPCLPPGSPPANAPAPVPAPAPAPAPAPQVLP
FT                   CYPGYQHTPPPDGPCWAPAGP"
     MQVGALFGRY RLDRSLTVDV SGEVWAAFDT VMFRQVVVRV LPPDATEDDE YCDRFEREAG        60
     IAAQIRNPHI VPIHDFGQVG NRLFLATPVT QGTNLRTILQ STGPMEVSRA VGVVEQLASA       120
     LEAVRVAGLV EQEVSSANVV VQDGGLVQLT DVGLPTILGA ASGVYGLTCV LYECLTGEVF       180
     PTSAIPTPPV GMAAVIARGT AADPARRYRS VGELAAAARV AAPPQQPAVE PAPATPPIDR       240
     NRRLIVAGLA LAAIVAVAIV GGVIIGSGTS SPHVAVPTPS SSAARPASPS SSPSAMANPT       300
     AAEQEPPVQA PPPTETPVAE APIQEEAIPT PAPQSPPVVP APAPPPGASA PQVLPCYPGY       360
     EHTPPPDGPC LPPGSPPANA PAPVPAPAPA PAPAPQVLPC YPGYQHTPPP DGPCWAPAGP       420
//

If you have problems or comments...

PBIL Back to PBIL home page