(data stored in ACNUC7421 zone)

EMBL: CP000431.PE28

CP000431.PE28        Location/Qualifiers
FT   CDS             complement(35002..35940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00028"
FT                   /product="possible universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91864"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS2"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91864.1"
FT                   /translation="MTDARTRSLAPVVVGVDGSVAARGAARWAAAVADKQGATVHLIHV
FT                   LPSPPVFYTEPRPLPSEDEDRIAGERFLADAVRNIRSDRHTVAVECSLPTGSTAADVLL
FT                   PLADSASMVVIGSTARGPVEGYLNATALRLAHHSPCPVVVWRGAEEHAIPDRRAVVVGV
FT                   DGSRCSVAAVADAADFAGRFAAPLVAVHSWKSRVPPDAENAPDGAAARPRERAVLAESL
FT                   AGLADRYPDLAVREIVESGGAGEVLLRWCVDAQLLVVGNHGHGALGRAVLGSTSQDVLH
FT                   RARCPVMISKVQRDTGTVPDQAVEFGDRGHR"
     MTDARTRSLA PVVVGVDGSV AARGAARWAA AVADKQGATV HLIHVLPSPP VFYTEPRPLP        60
     SEDEDRIAGE RFLADAVRNI RSDRHTVAVE CSLPTGSTAA DVLLPLADSA SMVVIGSTAR       120
     GPVEGYLNAT ALRLAHHSPC PVVVWRGAEE HAIPDRRAVV VGVDGSRCSV AAVADAADFA       180
     GRFAAPLVAV HSWKSRVPPD AENAPDGAAA RPRERAVLAE SLAGLADRYP DLAVREIVES       240
     GGAGEVLLRW CVDAQLLVVG NHGHGALGRA VLGSTSQDVL HRARCPVMIS KVQRDTGTVP       300
     DQAVEFGDRG HR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page