(data stored in ACNUC7421 zone)

EMBL: CP000431.PE281

CP000431.PE281       Location/Qualifiers
FT   CDS             complement(352088..353200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92117"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK19"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92117.1"
FT                   /translation="MSDTIRMFLAGDVMTGRGVDQILPFPGDPELRERCVRDARGYVAL
FT                   AEKRNGPIPGPVGFGWPWGEALPILDAAEPEARVVNLETTVTTCARFASKGINYRMHPS
FT                   NLGVLTAARIDVCVLANNHLLDFGADGLVETLDVLARNGVRTVGAGRTVAQAWCPVVVE
FT                   TGRGRRLLIWAAALPSSGVSSHGAARRGRPGVAYLPEPTPAEADNVLDRTRLIRRNTDV
FT                   VAVSLHWGSNWGYDVPDAHVEFAHRLVDGGVDVVFGHSSHHPRPVEIYRGHPILYGCGD
FT                   LINDYEGIGGHERFRDDLRLLYLVTLDARTHELLELRMVPMRSRQMQLHRASRRDTEWL
FT                   RRVLDGISRDFGTRIDVGDDVLVARANHAN"
     MSDTIRMFLA GDVMTGRGVD QILPFPGDPE LRERCVRDAR GYVALAEKRN GPIPGPVGFG        60
     WPWGEALPIL DAAEPEARVV NLETTVTTCA RFASKGINYR MHPSNLGVLT AARIDVCVLA       120
     NNHLLDFGAD GLVETLDVLA RNGVRTVGAG RTVAQAWCPV VVETGRGRRL LIWAAALPSS       180
     GVSSHGAARR GRPGVAYLPE PTPAEADNVL DRTRLIRRNT DVVAVSLHWG SNWGYDVPDA       240
     HVEFAHRLVD GGVDVVFGHS SHHPRPVEIY RGHPILYGCG DLINDYEGIG GHERFRDDLR       300
     LLYLVTLDAR THELLELRMV PMRSRQMQLH RASRRDTEWL RRVLDGISRD FGTRIDVGDD       360
     VLVARANHAN                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page