(data stored in ACNUC7421 zone)

EMBL: CP000431.PE282

CP000431.PE282       Location/Qualifiers
FT   CDS             complement(353287..353679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92118"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK18"
FT                   /protein_id="ABG92118.1"
FT                   /translation="MKVTAKATRCGGWWVVEVPGVEAALTQARRLDQVSAMVADAVHLV
FT                   EDVPAEDVEVVLDYEIGDSAALMEARAAQLQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILELSPQRVSQLDRADARTR"
     MKVTAKATRC GGWWVVEVPG VEAALTQARR LDQVSAMVAD AVHLVEDVPA EDVEVVLDYE        60
     IGDSAALMEA RAAQLQVESA AHAQECAARA SRAAVAHLRR SGLSVRDIGV ILELSPQRVS       120
     QLDRADARTR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page