(data stored in ACNUC7421 zone)

EMBL: CP000431.PE283

CP000431.PE283       Location/Qualifiers
FT   CDS             complement(353828..356866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00283"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0004674 - protein serine/threonine kinase
FT                   activity; GO_function: GO:0004713 - protein-tyrosine kinase
FT                   activity; GO_function: GO:0005524 - ATP binding;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent; GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation; GO_process: GO:0042829 - defense response
FT                   to pathogen"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92119"
FT                   /db_xref="GOA:Q0SK17"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK17"
FT                   /protein_id="ABG92119.1"
FT                   /translation="MADFDPDATQAAAVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDPENRERFLREGYAMGGLSGHPNIVNILQVGVTDAGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTA
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISSQPVPDLRAQGIPDGVCAVIERAMATNPAARPGSAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEAAQTTEEHPSDSGADGYRRIRYEGSDSGQRPWGE
FT                   PTQQLQPDSHPSGPPFWPPNGPPPWPPTGESGSIGESRTGRRAVLTVLALVVALVLAGG
FT                   GYLVLRETTGPGTARPTVQDAGASPAVDPTAAWRPVEDARVARQQTATTVADGTIWVFG
FT                   GLDENGVSAQQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWKAEGQNLTAV
FT                   DSDRVMAMRDGRWVDLPPLNAPRAAGAAAVVGDKIVVAGGQANGQLVATTEVFDGTKWT
FT                   TVAPVPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAGTWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEEPTRVLSTVEAYDVVAGTWSQLPALRTPRHGMAVGAVGNTVY
FT                   AVGGGIKPTHAESTAVSEALQLAPRKTQWAPAWRPLEDAPIARQQTATAVADGTIWVLG
FT                   GLDNAGSTPKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGI
FT                   TSDRVLALRNGKWMDLAPMNEPRAAGAAAVVGDKIVVAGGQADGALVATTEVFDGTKWT
FT                   TVSDIPTPREHLAGVSDGTYFYAIGGRDLASDQNTAAVERFDPAAATWTTLPAMPTPRG
FT                   GLGAAFIDGRIVAVGGEQPTKVLSTVEAYDVDSGTWSSLPPMPTGAHGMSVATVGHTAY
FT                   AIGGALRPTHAESTATAQALDFW"
     MADFDPDATQ AAAVRAVGHG IVAELDAAGF AGAEEVGRGG FGVVYRCLQR SLGRIVAIKV        60
     LTSDLDPENR ERFLREGYAM GGLSGHPNIV NILQVGVTDA GRPYIVMHYH PRDSLAVQIR       120
     REGPLPWPEA ISIGVKLAGA LETAHRTGTL HRDIKPANIL LTAYGEPQLT DFGIAHIAGG       180
     YETATGGFTG SLAFTAPEVL NGESPTARSD VYGLGATIFS LIAGRAAFER KTGEELVAQF       240
     VRISSQPVPD LRAQGIPDGV CAVIERAMAT NPAARPGSAE EFGHELQAAQ RHIGLRSDAM       300
     ALAPLEAAQT TEEHPSDSGA DGYRRIRYEG SDSGQRPWGE PTQQLQPDSH PSGPPFWPPN       360
     GPPPWPPTGE SGSIGESRTG RRAVLTVLAL VVALVLAGGG YLVLRETTGP GTARPTVQDA       420
     GASPAVDPTA AWRPVEDARV ARQQTATTVA DGTIWVFGGL DENGVSAQQE GYDPAIDTWK       480
     AGPDLPVPLN HAMAVTYNDE PVLIGGWKAE GQNLTAVDSD RVMAMRDGRW VDLPPLNAPR       540
     AAGAAAVVGD KIVVAGGQAN GQLVATTEVF DGTKWTTVAP VPTPREHLAG VSDGTYFYAI       600
     GGRDLASDQN TAAVERFDPA AGTWTTLPAM PTPRGGLGAA FIDGRIVAVG GEEPTRVLST       660
     VEAYDVVAGT WSQLPALRTP RHGMAVGAVG NTVYAVGGGI KPTHAESTAV SEALQLAPRK       720
     TQWAPAWRPL EDAPIARQQT ATAVADGTIW VLGGLDNAGS TPKVEGNDPA IDTWKAGPDL       780
     PVPLNHAMAV EYGGELVVLG GWVPEGPNLT GITSDRVLAL RNGKWMDLAP MNEPRAAGAA       840
     AVVGDKIVVA GGQADGALVA TTEVFDGTKW TTVSDIPTPR EHLAGVSDGT YFYAIGGRDL       900
     ASDQNTAAVE RFDPAAATWT TLPAMPTPRG GLGAAFIDGR IVAVGGEQPT KVLSTVEAYD       960
     VDSGTWSSLP PMPTGAHGMS VATVGHTAYA IGGALRPTHA ESTATAQALD FW              1012
//

If you have problems or comments...

PBIL Back to PBIL home page