(data stored in ACNUC7421 zone)

EMBL: CP000431.PE284

CP000431.PE284       Location/Qualifiers
FT   CDS             complement(357214..357504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00284"
FT                   /product="probable conserved signalling protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_function: GO:0005554 - molecular function
FT                   unknown; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92120"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK16"
FT                   /protein_id="ABG92120.1"
FT                   /translation="MRPGDTVARLGGDEFVVVCEDVAGAPEAGAIAARITGSLADLNRA
FT                   ESLDWPISASIGVALSDPECTREELVRRADSATYRAKAAGPGGYALYDGTF"
     MRPGDTVARL GGDEFVVVCE DVAGAPEAGA IAARITGSLA DLNRAESLDW PISASIGVAL        60
     SDPECTREEL VRRADSATYR AKAAGPGGYA LYDGTF                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page