(data stored in ACNUC7421 zone)

EMBL: CP000431.PE285

CP000431.PE285       Location/Qualifiers
FT   CDS             357816..358304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92121"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK15"
FT                   /protein_id="ABG92121.1"
FT                   /translation="MGMRRVRWPAFAPPAASGTAVHGPTILASKTHITLDLLGIIAFSS
FT                   GIHVRLALTATGRAAERAHHETRTLSDPTDPDTQWSYLSVLLQLGSVAGEADPYLPRSG
FT                   SPLKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCVTALLEPSPSAVTSD"
     MGMRRVRWPA FAPPAASGTA VHGPTILASK THITLDLLGI IAFSSGIHVR LALTATGRAA        60
     ERAHHETRTL SDPTDPDTQW SYLSVLLQLG SVAGEADPYL PRSGSPLKWG GVPAYRTEPN       120
     YWLGTCTRPH DIMISAGWPE IGLGPTCVTA LLEPSPSAVT SD                          162
//

If you have problems or comments...

PBIL Back to PBIL home page