(data stored in ACNUC7421 zone)

EMBL: CP000431.PE287

CP000431.PE287       Location/Qualifiers
FT   CDS             complement(358630..359907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00287"
FT                   /product="probable signal transduction histidine kinase in
FT                   2 component regulatory system"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0000155 - two-component sensor activity;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0046983 - protein dimerization activity; GO_process:
FT                   GO:0000160 - two-component signal transduction system
FT                   (phosphorelay); GO_process: GO:0006468 - protein amino acid
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92123"
FT                   /db_xref="GOA:Q0SK13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK13"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92123.1"
FT                   /translation="MAESSVLPADLGGSPDLERIILEHAYRGAYLQLALRGVLVLFIAL
FT                   TLAFVPPMNDAGVCVAVLICYALWSGGLALWTRRGGPGPVNAMWLALFGDLAVLGCLTL
FT                   LTGIAAQQSWTADILSNGLFVIPLLASTQLRPGVCASVVVPTVLIFLAASWATMASNEE
FT                   PWSSILLSTMALAVLGAGAVMLSRIQRSRVLTIGHLVRDRTALLAELMGLEQRERRALS
FT                   EQLHDGALQFVLAAKMDLDDLTGSADPEAVGRITHALTESATLLRATVSELHPTVLDRV
FT                   GLARALGDLTRSAQARGGFEVQLLTSEWVDDLRTSADDVLFSAARELLSNVVKHAQAGT
FT                   VRVELARWGEHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGSFSVHPGP
FT                   RSGTVAHIEMPFEIVTAPDSLTTSAH"
     MAESSVLPAD LGGSPDLERI ILEHAYRGAY LQLALRGVLV LFIALTLAFV PPMNDAGVCV        60
     AVLICYALWS GGLALWTRRG GPGPVNAMWL ALFGDLAVLG CLTLLTGIAA QQSWTADILS       120
     NGLFVIPLLA STQLRPGVCA SVVVPTVLIF LAASWATMAS NEEPWSSILL STMALAVLGA       180
     GAVMLSRIQR SRVLTIGHLV RDRTALLAEL MGLEQRERRA LSEQLHDGAL QFVLAAKMDL       240
     DDLTGSADPE AVGRITHALT ESATLLRATV SELHPTVLDR VGLARALGDL TRSAQARGGF       300
     EVQLLTSEWV DDLRTSADDV LFSAARELLS NVVKHAQAGT VRVELARWGE HAVLDVTDDG       360
     CGISREAIDR SLSRGHIGLT SHELRVVAAG GSFSVHPGPR SGTVAHIEMP FEIVTAPDSL       420
     TTSAH                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page