(data stored in ACNUC7421 zone)

EMBL: CP000431.PE288

CP000431.PE288       Location/Qualifiers
FT   CDS             complement(359989..361254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92124"
FT                   /db_xref="GOA:Q0SK12"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK12"
FT                   /protein_id="ABG92124.1"
FT                   /translation="MVPNPDPCEDRSRVPRTVRTRGRHPVSLRAQSATALVTAALAVAV
FT                   VASVDWQLCRGVFSPTELALFVIVGVVFVSAGLVAKWHRPQDNLGWLLVFAGLLWLVKG
FT                   FRLSTVPALFTAGAALTNMYIPVLIQLVFSFPWGRLRHRWERWFVGGSYAYYAVAVVSE
FT                   LAFLDTHRVSPAHPPSLNLLLVRDDPRVFAALQVIFGAVGIALGVVLIGVVVARWRSGS
FT                   PAYRAAVAPLWIAALLGTAATAWTPLVSVWVHSPQHAWTLLLRYPSTALIPLAVLAGMW
FT                   RYRVARAAVRNLMIEIGTAPLGDGFIEALRAALRDPDLALWSFSRARDGYVDAQGRPQV
FT                   LPPRNDPREATALIRDGVLVGALVYDRAVADLPRLLAAVRAATTLALDNQRLHGELEAQ
FT                   FAEVRRARELTAECQGSYTRRC"
     MVPNPDPCED RSRVPRTVRT RGRHPVSLRA QSATALVTAA LAVAVVASVD WQLCRGVFSP        60
     TELALFVIVG VVFVSAGLVA KWHRPQDNLG WLLVFAGLLW LVKGFRLSTV PALFTAGAAL       120
     TNMYIPVLIQ LVFSFPWGRL RHRWERWFVG GSYAYYAVAV VSELAFLDTH RVSPAHPPSL       180
     NLLLVRDDPR VFAALQVIFG AVGIALGVVL IGVVVARWRS GSPAYRAAVA PLWIAALLGT       240
     AATAWTPLVS VWVHSPQHAW TLLLRYPSTA LIPLAVLAGM WRYRVARAAV RNLMIEIGTA       300
     PLGDGFIEAL RAALRDPDLA LWSFSRARDG YVDAQGRPQV LPPRNDPREA TALIRDGVLV       360
     GALVYDRAVA DLPRLLAAVR AATTLALDNQ RLHGELEAQF AEVRRARELT AECQGSYTRR       420
     C                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page