(data stored in ACNUC7421 zone)

EMBL: CP000431.PE289

CP000431.PE289       Location/Qualifiers
FT   CDS             361424..362338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92125"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK11"
FT                   /protein_id="ABG92125.1"
FT                   /translation="MTRIRLRPAVALASIAGVSSLFLAACTQDASSTEGTESAAPSASS
FT                   EAPPTEAPVNGVDAKEYASSDAEADSYGFVTPSGKWLCAIIPTKNLAGCVSHPTAGPLG
FT                   VPGTPQIASPDGGPLAEANLIAVEAGKEPSFQNWNQAVFPGNANVLPYDTTLAIDGFSC
FT                   NVQFSGVSCREDATDKGFTISTSGYAFEFTPLPVSLPSASPPQIAPTPAPLPQQARGSN
FT                   QCGPVVYPETGKPATVVIVKGTLRCDEAHTMLTKYFAAPDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCSDDNGNTVVAQP"
     MTRIRLRPAV ALASIAGVSS LFLAACTQDA SSTEGTESAA PSASSEAPPT EAPVNGVDAK        60
     EYASSDAEAD SYGFVTPSGK WLCAIIPTKN LAGCVSHPTA GPLGVPGTPQ IASPDGGPLA       120
     EANLIAVEAG KEPSFQNWNQ AVFPGNANVL PYDTTLAIDG FSCNVQFSGV SCREDATDKG       180
     FTISTSGYAF EFTPLPVSLP SASPPQIAPT PAPLPQQARG SNQCGPVVYP ETGKPATVVI       240
     VKGTLRCDEA HTMLTKYFAA PDKSEPVYSF DGWECRLAGD PESAEIGYTI NCSDDNGNTV       300
     VAQP                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page