(data stored in ACNUC7421 zone)

EMBL: CP000431.PE290

CP000431.PE290       Location/Qualifiers
FT   CDS             362405..362722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK10"
FT                   /protein_id="ABG92126.1"
FT                   /translation="MHPPNDQAGTWEGSWLAAMTVIKSAQRVFTPENRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLIEWACQPDQPSEIREFGATLAFLSMKLT
FT                   T"
     MHPPNDQAGT WEGSWLAAMT VIKSAQRVFT PENRPPSELI PLVEPLSRLG DALRATPPDP        60
     EESRRRAADL VADRDLIEWA CQPDQPSEIR EFGATLAFLS MKLTT                       105
//

If you have problems or comments...

PBIL Back to PBIL home page