(data stored in ACNUC7421 zone)

EMBL: CP000431.PE292

CP000431.PE292       Location/Qualifiers
FT   CDS             363832..365406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92128"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK08"
FT                   /protein_id="ABG92128.1"
FT                   /translation="MRIARMRPGSAQRGVVTAALAVSVVLGVATSPMPAIASAETFFFD
FT                   DVGSTAVPRANCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLVGGLQDRGGGLLS
FT                   VTYDHCSYTSTFFPGNLLNPTTPGVQVLDVSNPAQPALSTTLNEPAMLGGTWESLKVNK
FT                   ARKLLAATAVPIAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFISHEGGFSPDGN
FT                   TYWVSGPAPGFLTAIDIRNPAEPRIIWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLD
FT                   ISAVQRGDPYPTVPQIATYLWTDGFFNQHSIPVTYGDKPYIFTVDETGGGGIKVFDVAD
FT                   PAHAEIVQKIKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPADPTALACSWESSG
FT                   IRVFDVRDLSRISEIAYYNPPAQTGKNVQLTNSPHALSSLIGVSLFNFVPLARAVFEGK
FT                   TDPRVAFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFIALQLDDAVYQPPVN
FT                   QVSTYGQ"
     MRIARMRPGS AQRGVVTAAL AVSVVLGVAT SPMPAIASAE TFFFDDVGST AVPRANCGPG        60
     SLPETGMQGD VPAEDRNNGR STQGYRCNMS LVGGLQDRGG GLLSVTYDHC SYTSTFFPGN       120
     LLNPTTPGVQ VLDVSNPAQP ALSTTLNEPA MLGGTWESLK VNKARKLLAA TAVPIAAGTG       180
     YFSVYDISDC AHPRLLNRGA GTDVTMPLPF ISHEGGFSPD GNTYWVSGPA PGFLTAIDIR       240
     NPAEPRIIWQ GLHGLGGHGF GITPDGNRMY LSNLGGITVL DISAVQRGDP YPTVPQIATY       300
     LWTDGFFNQH SIPVTYGDKP YIFTVDETGG GGIKVFDVAD PAHAEIVQKI KLEIQLPANT       360
     AANLRSSQGG SVFSYDPHYC VVDRPADPTA LACSWESSGI RVFDVRDLSR ISEIAYYNPP       420
     AQTGKNVQLT NSPHALSSLI GVSLFNFVPL ARAVFEGKTD PRVAFGPRAG MVAFGDLSAD       480
     WCFSPPEFHG NQIWTSCSDN GFIALQLDDA VYQPPVNQVS TYGQ                        524
//

If you have problems or comments...

PBIL Back to PBIL home page