(data stored in ACNUC7421 zone)

EMBL: CP000431.PE293

CP000431.PE293       Location/Qualifiers
FT   CDS             365396..366049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00293"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0000155 - two-component sensor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92129"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK07"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92129.1"
FT                   /translation="MGSDTTPSSFRRPLVLLLCAVLVGAAGVAAGMWLQSERATNPGGV
FT                   QLSSADIGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVSQTSEIAAMRGWLNL
FT                   FDEPFTTPHPMQWIQGSDHAMGDQGGAPMPGAASISEITRLAGLRGSDAETLFLQLMIR
FT                   HHQGGVDMAEAATDVVASEPIRRIARGMIRDQSNEIAVMTAILDTRNARPLPHP"
     MGSDTTPSSF RRPLVLLLCA VLVGAAGVAA GMWLQSERAT NPGGVQLSSA DIGFAQDMSV        60
     HHEQAVLIAQ TLPRDVDPQI RVIADQIVVS QTSEIAAMRG WLNLFDEPFT TPHPMQWIQG       120
     SDHAMGDQGG APMPGAASIS EITRLAGLRG SDAETLFLQL MIRHHQGGVD MAEAATDVVA       180
     SEPIRRIARG MIRDQSNEIA VMTAILDTRN ARPLPHP                                217
//

If you have problems or comments...

PBIL Back to PBIL home page