(data stored in ACNUC7421 zone)

EMBL: CP000431.PE294

CP000431.PE294       Location/Qualifiers
FT   CDS             366327..367085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00294"
FT                   /product="probable 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="GO_function: GO:0016616 - oxidoreductase activity,
FT                   acting on the CH-OH group of donors, NAD or NADP as
FT                   acceptor; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92130"
FT                   /db_xref="GOA:Q0SK06"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK06"
FT                   /protein_id="ABG92130.1"
FT                   /translation="MTTETTPVSIQREPELAGQTVVVIGGSAGIGLETARRARAEGAEV
FT                   ILTGRNSDRLAQAATEVGTRRTAAFDANDTASLARFFHDLPTPIDHVLVTAGGPRYAPL
FT                   LEMDSDEVREQLSGHVVLGLEVARNAASKMRPGGTLILMGGTGGRRIGHGLGIASAATA
FT                   ALPPFTAALALELAPVRVNLIAAGFVDTPLSASLLGDRLDERRNELRTTLPIGRVVGPA
FT                   DVAALAVHIMSNTALTGATYDIDGGQQFVS"
     MTTETTPVSI QREPELAGQT VVVIGGSAGI GLETARRARA EGAEVILTGR NSDRLAQAAT        60
     EVGTRRTAAF DANDTASLAR FFHDLPTPID HVLVTAGGPR YAPLLEMDSD EVREQLSGHV       120
     VLGLEVARNA ASKMRPGGTL ILMGGTGGRR IGHGLGIASA ATAALPPFTA ALALELAPVR       180
     VNLIAAGFVD TPLSASLLGD RLDERRNELR TTLPIGRVVG PADVAALAVH IMSNTALTGA       240
     TYDIDGGQQF VS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page