(data stored in ACNUC7421 zone)

EMBL: CP000431.PE295

CP000431.PE295       Location/Qualifiers
FT   CDS             367161..367793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00295"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016829 - lyase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92131"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK05"
FT                   /protein_id="ABG92131.1"
FT                   /translation="MSTNEVQTNDSTRTHVAPVDMKLEVVVIPVTDVDRATEFYTRLGW
FT                   RQDVTPPGSGVVQFTPPGADASIHFGADLTTAAPGSAKGYLIVSDIEAARDQLVAADIE
FT                   VTLFHLGPDGPGDGLDPDRRSYFSLASFSDPDGNAWVLQEVTTRLPGRIDTAVTSFGSA
FT                   RDLAAALRRAAAAHGGHEERTGEEDPNWPDWYAEYMAAEQSGAELPT"
     MSTNEVQTND STRTHVAPVD MKLEVVVIPV TDVDRATEFY TRLGWRQDVT PPGSGVVQFT        60
     PPGADASIHF GADLTTAAPG SAKGYLIVSD IEAARDQLVA ADIEVTLFHL GPDGPGDGLD       120
     PDRRSYFSLA SFSDPDGNAW VLQEVTTRLP GRIDTAVTSF GSARDLAAAL RRAAAAHGGH       180
     EERTGEEDPN WPDWYAEYMA AEQSGAELPT                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page