(data stored in ACNUC7421 zone)

EMBL: CP000431.PE296

CP000431.PE296       Location/Qualifiers
FT   CDS             368207..368617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92132"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK04"
FT                   /protein_id="ABG92132.1"
FT                   /translation="MEQGPQRTVGRRCPAPTTGSSPTDGPDFGGTYAPPWRAEYAAEAT
FT                   QRGKETATRISGRSILQIYFFDTDSSAESGIAAYNGPNPLPEPAAHSVVEVHLTPNYER
FT                   GTQWFVGLGTDYPQFQVTALTEPARIAVDIHD"
     MEQGPQRTVG RRCPAPTTGS SPTDGPDFGG TYAPPWRAEY AAEATQRGKE TATRISGRSI        60
     LQIYFFDTDS SAESGIAAYN GPNPLPEPAA HSVVEVHLTP NYERGTQWFV GLGTDYPQFQ       120
     VTALTEPARI AVDIHD                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page