(data stored in ACNUC7421 zone)

EMBL: CP000431.PE297

CP000431.PE297       Location/Qualifiers
FT   CDS             368769..369269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00297"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003676 - nucleic acid binding;
FT                   GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92133"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK03"
FT                   /protein_id="ABG92133.1"
FT                   /translation="MRDNRPAASALQLYRAFQHQHPRTPVPADYVTECGFRLGRWQDRQ
FT                   RIARMLGTLPPQRIEQLDAIGFLWSDDDVPLPAVSRTDAKRRRMLTAIAAYREEHGNAL
FT                   VPANYVTADGEQVGQWLYRAVKKWRADALPDKERRTLSVLGVSPGPRPRGPRTSAHLVG
FT                   QVM"
     MRDNRPAASA LQLYRAFQHQ HPRTPVPADY VTECGFRLGR WQDRQRIARM LGTLPPQRIE        60
     QLDAIGFLWS DDDVPLPAVS RTDAKRRRML TAIAAYREEH GNALVPANYV TADGEQVGQW       120
     LYRAVKKWRA DALPDKERRT LSVLGVSPGP RPRGPRTSAH LVGQVM                      166
//

If you have problems or comments...

PBIL Back to PBIL home page