(data stored in ACNUC7421 zone)

EMBL: CP000431.PE298

CP000431.PE298       Location/Qualifiers
FT   CDS             369410..370369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00298"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92134"
FT                   /db_xref="GOA:Q0SK02"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK02"
FT                   /protein_id="ABG92134.1"
FT                   /translation="MDVPHRVGVLVFDGVKMLDVAGPSEVFTEANRLGATYELVLCSVG
FT                   AVDVTASTGMRISVDVDAANTGRLSTALVMGGDLFPSTPVSPELAGAATTLAGNADRMA
FT                   SICTGAFILAAAGLLDGRRATTHWQHADTLARGYPRITVEPDAIFVEDGTIFSSAGVTA
FT                   GVDLALAFVERDHGTELARAVAQSLVVFLQRPGGQSQFSPSLRGPRPRTGQLREVVDAV
FT                   AADPTGDHSITRLAARANVSPRHLTRLFQDELGTTPAKYVELIRFDTAKAMLDAGHTVT
FT                   STAQHSGFGSPETLRRSFIQHLGVSPRAYRQQFHSTRR"
     MDVPHRVGVL VFDGVKMLDV AGPSEVFTEA NRLGATYELV LCSVGAVDVT ASTGMRISVD        60
     VDAANTGRLS TALVMGGDLF PSTPVSPELA GAATTLAGNA DRMASICTGA FILAAAGLLD       120
     GRRATTHWQH ADTLARGYPR ITVEPDAIFV EDGTIFSSAG VTAGVDLALA FVERDHGTEL       180
     ARAVAQSLVV FLQRPGGQSQ FSPSLRGPRP RTGQLREVVD AVAADPTGDH SITRLAARAN       240
     VSPRHLTRLF QDELGTTPAK YVELIRFDTA KAMLDAGHTV TSTAQHSGFG SPETLRRSFI       300
     QHLGVSPRAY RQQFHSTRR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page