(data stored in ACNUC7421 zone)

EMBL: CP000431.PE299

CP000431.PE299       Location/Qualifiers
FT   CDS             370504..371142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00299"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016787 - hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92135"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK01"
FT                   /protein_id="ABG92135.1"
FT                   /translation="MTDTVAGIEIPDTVVVNEATELVREAANPLIYHHSRRVFLFGSLR
FT                   ARHQKLAFDPELLYVGAMFHDLGLTAKYRRADQRFEIDGADEARTFLRSHGIGEDDADT
FT                   VWTSIALHTTPEIPLHMAPEIALLTRGVELDVLGIGYDAITDEERAAVVASHPRPDFKN
FT                   EILAAFTDGLEDRPDTTFGNVKADVLAHFVPGFVRGDFVDVILNSAWSE"
     MTDTVAGIEI PDTVVVNEAT ELVREAANPL IYHHSRRVFL FGSLRARHQK LAFDPELLYV        60
     GAMFHDLGLT AKYRRADQRF EIDGADEART FLRSHGIGED DADTVWTSIA LHTTPEIPLH       120
     MAPEIALLTR GVELDVLGIG YDAITDEERA AVVASHPRPD FKNEILAAFT DGLEDRPDTT       180
     FGNVKADVLA HFVPGFVRGD FVDVILNSAW SE                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page