(data stored in ACNUC7421 zone)

EMBL: CP000431.PE3

CP000431.PE3         Location/Qualifiers
FT   CDS             4147..5319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91839"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S091"
FT                   /protein_id="ABG91839.1"
FT                   /translation="MALLVRVRTRPGPTAPGGHGRGTAPGNVAAHRLDHRVLAVDACAC
FT                   GWIWRRSSTRGAHRALRRRLHALPATGIAPQLPPPKPRCARAELAARALLVSRTDMPTL
FT                   RCCTKFAHHCGSPDPTASAPRKLSASDPAPVAEPAIRSGAAFIPVACRRRTMGELVDRP
FT                   DVVERSDQEAPMPRPSSWVRTTASALGEELARIGLTVPADRLEDLLTDRVAAVAERMHI
FT                   TERTARRYFDPHALRTLARELALRINDEAPGADLLTLPRTIAMPLPTLGATIAALVEVA
FT                   ALAGADTGPDEPATAMSMISTLGVLTREHDGHLPTVWVPEPLLVRAVRLIENTADLVHH
FT                   GCTLPPGVAEDVRPHLRKALSDDAARLRALTPHTGRRTGPGLWAVPDDPR"
     MALLVRVRTR PGPTAPGGHG RGTAPGNVAA HRLDHRVLAV DACACGWIWR RSSTRGAHRA        60
     LRRRLHALPA TGIAPQLPPP KPRCARAELA ARALLVSRTD MPTLRCCTKF AHHCGSPDPT       120
     ASAPRKLSAS DPAPVAEPAI RSGAAFIPVA CRRRTMGELV DRPDVVERSD QEAPMPRPSS       180
     WVRTTASALG EELARIGLTV PADRLEDLLT DRVAAVAERM HITERTARRY FDPHALRTLA       240
     RELALRINDE APGADLLTLP RTIAMPLPTL GATIAALVEV AALAGADTGP DEPATAMSMI       300
     STLGVLTREH DGHLPTVWVP EPLLVRAVRL IENTADLVHH GCTLPPGVAE DVRPHLRKAL       360
     SDDAARLRAL TPHTGRRTGP GLWAVPDDPR                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page