(data stored in ACNUC7421 zone)

EMBL: CP000431.PE30

CP000431.PE30        Location/Qualifiers
FT   CDS             complement(36733..37650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00030"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="tc: 3.A.1; GO_component: GO:0016020 - membrane;
FT                   GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0015087 - cobalt ion transporter activity; GO_function:
FT                   GO:0016887 - ATPase activity; GO_process: GO:0006824 -
FT                   cobalt ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91866"
FT                   /db_xref="GOA:Q0SKS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS0"
FT                   /protein_id="ABG91866.1"
FT                   /translation="MSDTIAMCTVGLSKRFGSVLALDAVDLNVVEGEVFGYLGPNGAGK
FT                   STTLRLLTGLLRPTAGSARVLGLDAWSAAPAVHRRIGYVPGELALYDRLTGRQHITFFG
FT                   HLRGDPVDKAATVFADRLDLDLDLDRTARTMSKGNRQKLALVLALMSGPQLLILDEPTG
FT                   GLDPLVQHEFHAIIREHTASGGTVLLSSHVLGEVQQVADRVGVLREGRLIAVESLHELR
FT                   QKSLHHVTAECSTPIQESDFRDVAGIRGLTVAGTSLTCSAPQSALDALIRRISHYGIVD
FT                   FECAEADLEETFMAFYEIRDRHAA"
     MSDTIAMCTV GLSKRFGSVL ALDAVDLNVV EGEVFGYLGP NGAGKSTTLR LLTGLLRPTA        60
     GSARVLGLDA WSAAPAVHRR IGYVPGELAL YDRLTGRQHI TFFGHLRGDP VDKAATVFAD       120
     RLDLDLDLDR TARTMSKGNR QKLALVLALM SGPQLLILDE PTGGLDPLVQ HEFHAIIREH       180
     TASGGTVLLS SHVLGEVQQV ADRVGVLREG RLIAVESLHE LRQKSLHHVT AECSTPIQES       240
     DFRDVAGIRG LTVAGTSLTC SAPQSALDAL IRRISHYGIV DFECAEADLE ETFMAFYEIR       300
     DRHAA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page