(data stored in ACNUC7421 zone)

EMBL: CP000431.PE300

CP000431.PE300       Location/Qualifiers
FT   CDS             complement(371159..372382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00300"
FT                   /product="MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92136"
FT                   /db_xref="GOA:Q0SK00"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK00"
FT                   /experiment="2DGE; MS"
FT                   /protein_id="ABG92136.1"
FT                   /translation="MAIAPHESTDAIAHELAGWAVGIEPGAGDLDLARRALVDTIAVTL
FT                   AALDDPAAAWTDGLPAALRWAAVGHVLDFDDLHIPSTTHISVVCVPATLSAGGGGREYL
FT                   AAAGVMARLGTALGWNHYTQGWHTTATVGAISAAVAAGLSFGLDSEGIATAMAHAVPAA
FT                   GGVRQAFGTAGKSIQVGFAAQAGVRAAGLAAAGATADPRAVGEWFRLVGGRMSPHVEGP
FT                   IIPDGLGLKLHPCCYALQRPIAAVRSLGSLSVDDIARIRVHTPNSAVLPLIHNFPSSGL
FT                   EGKFSLNYGIAAALLDGFPDIGSFTDPAVQRPEVRSILDRVSLVAEPVGEGVLDGDCTV
FT                   VVELRDGSQLEAVVDLPVGHPRRPASVADFEAKVRGCVGDERAAEILNLDWVSAAALLQ
FT                   RHLPGGGN"
     MAIAPHESTD AIAHELAGWA VGIEPGAGDL DLARRALVDT IAVTLAALDD PAAAWTDGLP        60
     AALRWAAVGH VLDFDDLHIP STTHISVVCV PATLSAGGGG REYLAAAGVM ARLGTALGWN       120
     HYTQGWHTTA TVGAISAAVA AGLSFGLDSE GIATAMAHAV PAAGGVRQAF GTAGKSIQVG       180
     FAAQAGVRAA GLAAAGATAD PRAVGEWFRL VGGRMSPHVE GPIIPDGLGL KLHPCCYALQ       240
     RPIAAVRSLG SLSVDDIARI RVHTPNSAVL PLIHNFPSSG LEGKFSLNYG IAAALLDGFP       300
     DIGSFTDPAV QRPEVRSILD RVSLVAEPVG EGVLDGDCTV VVELRDGSQL EAVVDLPVGH       360
     PRRPASVADF EAKVRGCVGD ERAAEILNLD WVSAAALLQR HLPGGGN                     407
//

If you have problems or comments...

PBIL Back to PBIL home page