(data stored in ACNUC7421 zone)

EMBL: CP000431.PE31

CP000431.PE31        Location/Qualifiers
FT   CDS             37808..38821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91867"
FT                   /db_xref="GOA:Q0SKR9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR9"
FT                   /protein_id="ABG91867.1"
FT                   /translation="MRSTEEAIVDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYADG
FT                   QLDLYTERGRLLASTDPSGRQLVVSCGAALNHLETALTGLKWSVDIRRVPEGPHSGHLA
FT                   TIRFRHDARPQSHDFDLLAAIRHRYSDRRPFGPVSMKTPLPPALTDVTRRVDVHLTLLA
FT                   QDARPTLAKATELTAAARKYDSAYQAELHWWAGHSIPQGGIPADSLATAENRDRVDIGR
FT                   RFPAGRDNDASPGIDRSTVLVLSTDTDGREAWLRAGEALSAVLLEATVGGLATCPLTHM
FT                   TELRQSREMIRELVPDRGFPQALIRVGTTEKKSPPRQTPRRPVESVFSIGRRHSTR"
     MRSTEEAIVD STIPDENVVR IAVDLACRAP SVHNSQPWQW TYADGQLDLY TERGRLLAST        60
     DPSGRQLVVS CGAALNHLET ALTGLKWSVD IRRVPEGPHS GHLATIRFRH DARPQSHDFD       120
     LLAAIRHRYS DRRPFGPVSM KTPLPPALTD VTRRVDVHLT LLAQDARPTL AKATELTAAA       180
     RKYDSAYQAE LHWWAGHSIP QGGIPADSLA TAENRDRVDI GRRFPAGRDN DASPGIDRST       240
     VLVLSTDTDG REAWLRAGEA LSAVLLEATV GGLATCPLTH MTELRQSREM IRELVPDRGF       300
     PQALIRVGTT EKKSPPRQTP RRPVESVFSI GRRHSTR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page