(data stored in ACNUC7421 zone)

EMBL: CP000431.PE32

CP000431.PE32        Location/Qualifiers
FT   CDS             complement(38846..39313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00032"
FT                   /product="hydrogenase maturation protease"
FT                   /note="GO_component: GO:0009375 - ferredoxin hydrogenase
FT                   complex; GO_function: GO:0004222 - metalloendopeptidase
FT                   activity; GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0046872 - metal ion binding;
FT                   GO_process: GO:0016485 - protein processing"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91868"
FT                   /db_xref="GOA:Q0SKR8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR8"
FT                   /protein_id="ABG91868.1"
FT                   /translation="MTVVVIGLGNELRRDDGIGPAVARQVADRVAPDVRVSVSDGDPAA
FT                   LLDAWAGAQLAVLVDAVVCEPSRPGTVHRFTPDELAGVRAGRFSTHGISLGDIIQLGTV
FT                   LDRLPHRMVVLAVEVADLAAGGGLSPAVGRAVETAVAAVLSVLGEPLAEMS"
     MTVVVIGLGN ELRRDDGIGP AVARQVADRV APDVRVSVSD GDPAALLDAW AGAQLAVLVD        60
     AVVCEPSRPG TVHRFTPDEL AGVRAGRFST HGISLGDIIQ LGTVLDRLPH RMVVLAVEVA       120
     DLAAGGGLSP AVGRAVETAV AAVLSVLGEP LAEMS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page