(data stored in ACNUC7421 zone)

EMBL: CP000431.PE33

CP000431.PE33        Location/Qualifiers
FT   CDS             complement(39310..40578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00033"
FT                   /product="Ni-dependent hydrogenase large subunit"
FT                   /note="GO_function: GO:0008901 - ferredoxin hydrogenase
FT                   activity; GO_function: GO:0016151 - nickel ion binding;
FT                   GO_function: GO:0047806 - cytochrome-c3 hydrogenase
FT                   activity; GO_process: GO:0006118 - electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91869"
FT                   /db_xref="GOA:Q0SKR7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKR7"
FT                   /protein_id="ABG91869.1"
FT                   /translation="MVRALARVEGEGRVDVTVREGRAEHVTLDIYEPPRFFESFLRDRH
FT                   FLEPPDITSRICGICPVAYQVSACNAIEQACGLELDDDVRDLRRLLYCGEWIASHVLHI
FT                   YFLHAPDFLGLPDSIALARHDREAVERGLSLKKAGNAILDAIGGRPIHPVNVRIGGFHR
FT                   APTAAELIPLSDQLRTALDHAVATVRWVSSFDFPDIELDHDLLALHDDSRYAIEDGEIR
FT                   SSTGLRCTADEFPKHVVEHQVPHSTALHAELDGRRYLTGPLARYSLNSSRLGGVAARTA
FT                   ADAGLGAQCRNPYRSIVVRAVEVVYAVEEALRIIDRYERPPQPFTAGSPIRTVGHGVSE
FT                   APRGLLYHRYEVDPAGLIRAATIVPPTSQNQAAIEHDLRRAVDGNLMLADDELTTLCER
FT                   TIRNYDPCISCATHFLTLTVDRR"
     MVRALARVEG EGRVDVTVRE GRAEHVTLDI YEPPRFFESF LRDRHFLEPP DITSRICGIC        60
     PVAYQVSACN AIEQACGLEL DDDVRDLRRL LYCGEWIASH VLHIYFLHAP DFLGLPDSIA       120
     LARHDREAVE RGLSLKKAGN AILDAIGGRP IHPVNVRIGG FHRAPTAAEL IPLSDQLRTA       180
     LDHAVATVRW VSSFDFPDIE LDHDLLALHD DSRYAIEDGE IRSSTGLRCT ADEFPKHVVE       240
     HQVPHSTALH AELDGRRYLT GPLARYSLNS SRLGGVAART AADAGLGAQC RNPYRSIVVR       300
     AVEVVYAVEE ALRIIDRYER PPQPFTAGSP IRTVGHGVSE APRGLLYHRY EVDPAGLIRA       360
     ATIVPPTSQN QAAIEHDLRR AVDGNLMLAD DELTTLCERT IRNYDPCISC ATHFLTLTVD       420
     RR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page